PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_02035.1_g00004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 298aa    MW: 33959 Da    PI: 6.6345
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_02035.1_g00004.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM178.51.8e-5561321128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                              lppGfrFhP+deel+++yL +kv++ +++  ++i++vd++k+ePwdLp+k++ +ekewyfFs +d+ky+tg r+nrat++gyWk+t
  Sme2.5_02035.1_g00004.1   6 LPPGFRFHPSDEELITYYLSNKVSDFTFTS-RAIADVDLNKSEPWDLPAKASMGEKEWYFFSLKDRKYPTGLRTNRATEAGYWKTT 90 
                              79*************************999.89***************999999******************************** PP

                      NAM  87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              gkdke+++ + elvg+kktLvfy+grapkgekt+Wvmheyrl
  Sme2.5_02035.1_g00004.1  91 GKDKEIFRGGVELVGMKKTLVFYRGRAPKGEKTNWVMHEYRL 132
                              ********99999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.09E-633154IPR003441NAC domain
PROSITE profilePS5100560.1616153IPR003441NAC domain
PfamPF023652.1E-287132IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MDEENLPPGF RFHPSDEELI TYYLSNKVSD FTFTSRAIAD VDLNKSEPWD LPAKASMGEK  60
EWYFFSLKDR KYPTGLRTNR ATEAGYWKTT GKDKEIFRGG VELVGMKKTL VFYRGRAPKG  120
EKTNWVMHEY RLQSNHGFKH SKDEWVVCRV FHKNSISKKA QPTSSSQQSD QVESPCDTYT  180
LANDIDLPSF NLATPSIGNG TVTNIHNMNM NLTNTNTLPL LPAAWSNNLP SVNSLLFRAL  240
QLRGNYNHQP TNDYPFNIIQ SQFGIDFNPL EASSSSMVFD PLQAQAEQAY KFDANIWD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A4e-56115915174NAC domain-containing protein 19
3swm_B4e-56115915174NAC domain-containing protein 19
3swm_C4e-56115915174NAC domain-containing protein 19
3swm_D4e-56115915174NAC domain-containing protein 19
3swp_A4e-56115915174NAC domain-containing protein 19
3swp_B4e-56115915174NAC domain-containing protein 19
3swp_C4e-56115915174NAC domain-containing protein 19
3swp_D4e-56115915174NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00364DAPTransfer from AT3G18400Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016555864.11e-153PREDICTED: protein CUP-SHAPED COTYLEDON 3
SwissprotQ9FLR31e-81NAC79_ARATH; NAC domain-containing protein 79
TrEMBLM1CT221e-145M1CT22_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000740481e-144(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15224279
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18400.11e-100NAC domain containing protein 58